NOTE
If your issue is for security or deals with sensitive info please mark it as private using the checkbox below.
I receive emails from pagure issues, e.g. this one https://pagure.io/fedora-magazine-newsroom/issue/108 but when I reply by email (any of the email addresses associated with pagure.io settings), it bounces back. Raw email of the bounce attached.
N/A I can of course just comment in pagure.io - which BTW is how I added the comment that's there now: https://pagure.io/fedora-magazine-newsroom/issue/108#comment-809652
Return-Path: <> Received: from compute2.internal (compute2.nyi.internal [10.202.2.46]) by sloti50n28 (Cyrus 3.7.0-alpha0-758-ge0d20a54e1-fm-20220729.001-ge0d20a54) with LMTPA; Sun, 07 Aug 2022 11:43:21 -0400 X-Cyrus-Session-Id: sloti50n28-1659887001-4170675-2-7743084409570728519 X-Sieve: CMU Sieve 3.0 X-Spam-known-sender: no X-Spam-sender-reputation: 500 (none) X-Spam-score: 0.0 X-Spam-hits: ALL_TRUSTED -1, ME_SENDERREP_NEUTRAL 0.001, SPF_HELO_PASS -0.001, SPF_PASS -0.001, T_SCC_BODY_TEXT_LINE -0.01, LANGUAGES en, BAYES_USED none, SA_VERSION 3.4.6 X-Spam-source: IP='Unknown', Host='unk', Country='unk', FromHeader='com', MailFrom='unk' X-Spam-charsets: plain='us-ascii' X-Resolved-to: chris@colorremedies.com X-Delivered-to: chris@colorremedies.com X-Mail-from: Received: from mx3 ([10.202.2.202]) by compute2.internal (LMTPProxy); Sun, 07 Aug 2022 11:43:21 -0400 Received: from mx3.messagingengine.com (localhost [127.0.0.1]) by mailmx.nyi.internal (Postfix) with ESMTP id 1CE021960156 for <chris@colorremedies.com>; Sun, 7 Aug 2022 11:43:21 -0400 (EDT) Received: from mailmx.nyi.internal (localhost [127.0.0.1]) by mx3.messagingengine.com (Authentication Milter) with ESMTP id B3B8363C3A4; Sun, 7 Aug 2022 11:43:21 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=messagingengine.com; s=fm1; t= 1659887001; b=LmQ8SqdHkjXPWqAsP9Xw0vdo6YepJNz1/dks/dSSTm7B35wHgr yeXoyn8MENvVpEYgcVYWiwvYf6hIOT8K913I9XOya2FbDrD39lfGiSrYiC+95xDn g7vlWucfkOgxvZNOQixDENDqFlq/UTpdAvcZYFM1IeHbiyndA7qlMCOh7b4MgNrR eg1RBZxXZMFnWW37O5o2s5SJ3kgTu1yje4ewDHIGhl9yvRRNAx55uMdQa6rhfgt/ qqyjK4owgi1R5DjrNDzxdnzcun2pCVy0o5k1IYM904wQ70lmvwpxPCV9jGe9TZ+h dWYwTo003X9hwXSemU1Ig/kvR4GE+RoXuFpw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=date:from:subject:to:mime-version :content-type:message-id; s=fm1; t=1659887001; bh=Wa08NSYacsFYnQ BfYZop+WT7n1zqkADN6G19LU+che0=; b=zuaCimgZ49SsrtSk07b1YNCfKzfwor K4TJ98fPck17ctl4g4StE+CGl8aNJ6bVkYJs4+nopv5nKfmJF5EbmE+wSLUZXcL2 uquDghevdgF5Vtg57WIl+rYHLC0seQdA4H79OMRNpJV1517KVvQyj4jOWaPo+aJE lmG8F+M1wv9EFArhsuYnptKhBNzoePxBfOma15Wvs8uOHKPpLE517TZwXS/rsBS0 0//sKAnFnhE23V3LzcnZh1uNPEc4bgEtYFC7wYRcyVp8ECVlhEYlHjPET19BylAa pdf0PfJlxho0sygN1NBL2NephtXyRGfvICBiuzkDypdd5nPdiY1PVVRg== ARC-Authentication-Results: i=1; mx3.messagingengine.com; x-csa=none; x-me-sender=none; x-ptr=pass smtp.helo=new1-smtp.messagingengine.com policy.ptr=new1-smtp.messagingengine.com; bimi=skipped (DMARC Policy is not at enforcement); arc=none (no signatures found); dkim=none (no signatures found); dmarc=pass policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=messagingengine.com; iprev=pass smtp.remote-ip=66.111.4.221 (new1-smtp.messagingengine.com); spf=pass smtp.mailfrom="" smtp.helo=new1-smtp.messagingengine.com X-ME-Authentication-Results: mx3.messagingengine.com; x-aligned-from=null_smtp (No envelope domain); x-return-mx=fail smtp.domain=localhost.localdomain policy.org_domain=localdomain policy.is_org=no policy.mx_error=NXDOMAIN policy.a_error=NXDOMAIN policy.aaaa_error=NXDOMAIN policy.org_mx_error=NXDOMAIN policy.org_a_error=NXDOMAIN policy.org_aaaa_error=NXDOMAIN; x-return-mx=pass header.domain=messagingengine.com policy.is_org=yes (MX Records found: in1-smtp.messagingengine.com,in2-smtp.messagingengine.com); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384 smtp.bits=256/256; x-vs=bounce score=10000 state=3 Authentication-Results: mx3.messagingengine.com; x-csa=none; x-me-sender=none; x-ptr=pass smtp.helo=new1-smtp.messagingengine.com policy.ptr=new1-smtp.messagingengine.com Authentication-Results: mx3.messagingengine.com; bimi=skipped (DMARC Policy is not at enforcement) Authentication-Results: mx3.messagingengine.com; arc=none (no signatures found) Authentication-Results: mx3.messagingengine.com; dkim=none (no signatures found); dmarc=pass policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=messagingengine.com; iprev=pass smtp.remote-ip=66.111.4.221 (new1-smtp.messagingengine.com); spf=pass smtp.mailfrom="" smtp.helo=new1-smtp.messagingengine.com X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvfedrvdefiedgleehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucfpohhtihhfihgtrghtih honhculddutddttddtmdenucfjughrpeffhffuvfggtgesphdttdertddtvdenucfhrhho mhepofetkffngfftqdfftefgoffqpfesmhgvshhsrghgihhnghgvnhhgihhnvgdrtghomh culdforghilhcuffgvlhhivhgvrhihucfuhihsthgvmhdmnecuggftrfgrthhtvghrnhep feevieffudekheejvdeiudejvdeiteeiueelkeeiheevgedtveeiudejtdelffevnecuff homhgrihhnpehfrghsthhmrghilhdrhhgvlhhpnecukfhppeeiiedrudduuddrgedrvddv udenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeeiiedrudduud drgedrvddvuddphhgvlhhopehnvgifuddqshhmthhprdhmvghsshgrghhinhhgvghnghhi nhgvrdgtohhmpdhmrghilhhfrhhomhepoeeq X-ME-VSScore: 10000 X-ME-VSCategory: bounce X-ME-CSA: none Received-SPF: pass (new1-smtp.messagingengine.com: Sender is authorized to use 'new1-smtp.messagingengine.com' in 'helo' identity (mechanism 'include:spf.messagingengine.com' matched)) receiver=mx3.messagingengine.com; identity=helo; helo=new1-smtp.messagingengine.com; client-ip=66.111.4.221 Received: from mailnew.nyi.internal (outbound1.nyi.internal [10.202.2.181]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by mailmx.nyi.internal (Postfix) with ESMTPS for <chris@colorremedies.com>; Sun, 7 Aug 2022 11:43:20 -0400 (EDT) Received: by mailnew.nyi.internal (Postfix) id DF9DE5802A2; Sun, 7 Aug 2022 11:43:20 -0400 (EDT) Date: Sun, 7 Aug 2022 11:43:20 -0400 (EDT) From: MAILER-DAEMON@messagingengine.com (Mail Delivery System) Subject: Undelivered Mail Returned to Sender To: chris@colorremedies.com Auto-Submitted: auto-replied MIME-Version: 1.0 Content-Type: multipart/report; report-type=delivery-status; boundary="502D85801A4.1659887000/mailnew.nyi.internal" Message-Id: <20220807154320.DF9DE5802A2@mailnew.nyi.internal> This is a MIME-encapsulated message. --502D85801A4.1659887000/mailnew.nyi.internal Content-Description: Notification Content-Type: text/plain; charset=us-ascii This is an automated message from the mail system at Fastmail. I'm sorry to have to inform you that your message could not be delivered to one or more recipients. It's attached below. For further assistance, please read our help center article about message bounces https://www.fastmail.help/hc/en-us/articles/360058753614-Why-messages-bounce-back If you would like to reach out to our support team about the issue then please include this problem report. The Fastmail support team. new.outbound1 <reply+c72ffda5eeb32e5fa87f0605e8fd06b3b5e4093535d72e30776677a2f720c47c3ea47ea92fb1baaa8df0c34ed7a12a0ed704d3007c40fd8bb8a8f936be1aed2e@pagure.io>: host pagure.io[8.43.85.76] said: 550 5.7.1 Reply authentication failed. (in reply to end of DATA command) --502D85801A4.1659887000/mailnew.nyi.internal Content-Description: Delivery report Content-Type: message/delivery-status Reporting-MTA: dns; mailnew.nyi.internal X-Postfix-Queue-ID: 502D85801A4 X-Postfix-Sender: rfc822; chris@colorremedies.com Arrival-Date: Sun, 7 Aug 2022 11:43:20 -0400 (EDT) Final-Recipient: rfc822; reply+c72ffda5eeb32e5fa87f0605e8fd06b3b5e4093535d72e30776677a2f720c47c3ea47ea92fb1baaa8df0c34ed7a12a0ed704d3007c40fd8bb8a8f936be1aed2e@pagure.io Original-Recipient: rfc822;reply+c72ffda5eeb32e5fa87f0605e8fd06b3b5e4093535d72e30776677a2f720c47c3ea47ea92fb1baaa8df0c34ed7a12a0ed704d3007c40fd8bb8a8f936be1aed2e@pagure.io Action: failed Status: 5.7.1 Remote-MTA: dns; pagure.io Diagnostic-Code: smtp; 550 5.7.1 Reply authentication failed. --502D85801A4.1659887000/mailnew.nyi.internal Content-Description: Undelivered Message Content-Type: message/rfc822 Return-Path: <chris@colorremedies.com> Received: from compute3.internal (compute3.nyi.internal [10.202.2.43]) by mailnew.nyi.internal (Postfix) with ESMTP id 502D85801A4 for <reply+c72ffda5eeb32e5fa87f0605e8fd06b3b5e4093535d72e30776677a2f720c47c3ea47ea92fb1baaa8df0c34ed7a12a0ed704d3007c40fd8bb8a8f936be1aed2e@pagure.io>; Sun, 7 Aug 2022 11:43:20 -0400 (EDT) Received: from imap50 ([10.202.2.100]) by compute3.internal (MEProxy); Sun, 07 Aug 2022 11:43:20 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= colorremedies.com; h=cc:content-type:date:date:from:from :in-reply-to:in-reply-to:message-id:mime-version:references :reply-to:sender:subject:subject:to:to; s=fm1; t=1659887000; x= 1659890600; bh=aZLV5SoEo1z+xr39NhYhAVDCmFCwaHVUV+YVfse+XpE=; b=p LoxGHc2gyBARUvlXYmEAoocBidgTrNtmoB5VLAV532g4LlSqwXL34fvvYojZcROS mUEmHPCBi1RTd8xCMqI8J5vIyDd2pIO7m8PvX7LJd1YVEg3MlTrggC3lgzkmPJsv jEilA/+rw9cYrUdPn8b8ZwpCALVVVRvKIR///A6nwDBMWBFaaI3ZFOVUze0KNqJ9 OW7+4kWIFULsyO5OxkvnPFvah+kuvQ/iNO+IREkB+fAXtDxooim+jQi8+A7iHBaY tfcoLbLVeEMLf5Ng9GkPf8stqDt1nWRVJ8y1DK+j6+g8gFrxNtiUVTBoqgnBuyQL TH2/CPeL99+hUyatULNZw== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:date:feedback-id :feedback-id:from:from:in-reply-to:in-reply-to:message-id :mime-version:references:reply-to:sender:subject:subject:to:to :x-me-proxy:x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s= fm1; t=1659887000; x=1659890600; bh=aZLV5SoEo1z+xr39NhYhAVDCmFCw aHVUV+YVfse+XpE=; b=b30kpAoFLYpCGXB6B44vRbx0zcGeEWsySRNTTWXVD5Qr i6XKcatU1FT2jBSfye7a0eRzAa+yenCbTwo0BTdRRejuaAOFQgv8BeSfyiwN7eQf AzT/WglfqLYmrPqczBmrEwjZj0kKKy9I5KQLBuxT8fHK5FW0QzR2yDeL1tlJxgXt Sgk1f1QumvLAxLx7qUlB8aX3a608/0jcoCoIBhNBRYQQUqrdo3wH2aMvr+j0Tt7l th1o0LLgBhdo95bzNCYcoSNQyOdi26HJSaaLJ7qiia1Y7uV/ANrW+Te5oAYhHpg3 iwGFF0C538w3CRalQoN1JdDfGTyfq9MJb3eF/0IlxA== X-ME-Sender: <xms:mN3vYssqSRIxcnECNaNmt8xJ99wSSd8X16tMEZgdT3aEyqU0OgnQ0Q> <xme:mN3vYpe2s0o8ygPV-hWagsApf4IwThRhn-oMJinuQUU217fN1G5yyRI7OlAL4vxEI iTNnJbNES7MSUPa_Ko> X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvfedrvdefiedgleehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdfqfgfvpdfurfetoffkrfgpnffqhgen uceurghilhhouhhtmecufedttdenucenucfjughrpefofgggkfgjfhffhffvufgtsehttd ertderredtnecuhfhrohhmpedfvehhrhhishcuofhurhhphhihfdcuoegthhhrihhssegt ohhlohhrrhgvmhgvughivghsrdgtohhmqeenucggtffrrghtthgvrhhnpeffueegheelhf efvdejieehfeeggfekvddvvdeggeffjeekheeuvdfhudevteeuudenucevlhhushhtvghr ufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpegthhhrihhssegtohhlohhrrh gvmhgvughivghsrdgtohhm X-ME-Proxy: <xmx:mN3vYnzAJIGeZg9ujlxKhPGsO9yVraMKWoJO4TziI0bxLZ5byJ3Vkw> <xmx:mN3vYvPIyEBH5pn06uPBwJEcDilevmuiEhp6FF_WdgVmcDFEwDIIWQ> <xmx:mN3vYs-lTzCX9RaZMDUco5hJ046qaJV5eXgkCvL6J2JEwGok84jxHg> <xmx:mN3vYvIDqp1JnYx_fQ5lpxt_DnZkTvhBboPLtWTursGi7cd_8i9dxg> Feedback-ID: i07814636:Fastmail Received: by mailuser.nyi.internal (Postfix, from userid 501) id 03B4E170007E; Sun, 7 Aug 2022 11:43:20 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface Fastmail-Sender-Identity: 127414872 User-Agent: Cyrus-JMAP/3.7.0-alpha0-758-ge0d20a54e1-fm-20220729.001-ge0d20a54 Mime-Version: 1.0 X-PersonalityId: 127414872 Message-Id: <26eed90d-920b-4f26-8c87-17add93ac4b0@www.fastmail.com> In-Reply-To: <fedora-magazine-newsroom-ticket-3ff0e262c8564e00aedd3332f36bc6c5-809651@pagure.io> References: <fedora-magazine-newsroom-ticket-3ff0e262c8564e00aedd3332f36bc6c5-809651@pagure.io> Date: Sun, 07 Aug 2022 11:42:58 -0400 From: "Chris Murphy" <chris@colorremedies.com> To: reply+c72ffda5eeb32e5fa87f0605e8fd06b3b5e4093535d72e30776677a2f720c47c3ea47ea92fb1baaa8df0c34ed7a12a0ed704d3007c40fd8bb8a8f936be1aed2e@pagure.io Subject: Re: [fedora-magazine-newsroom] Issue #108: Understanding BTRFS and putting it to good use "General Explanation" Content-Type: text/plain > I'd be very happy if you could give the article another read! Could anyone post an updated link to the article? The earlier one has expired. Thanks. --502D85801A4.1659887000/mailnew.nyi.internal--
Metadata Update from @phsmoura: - Issue priority set to: Waiting on Assignee (was: Needs Review) - Issue tagged with: low-gain, low-trouble, ops
Just a test.
Please ignore.
kevin
So, I think this is because your email in fas is not the same as the one you were sending from. So, pagure doesn't know how to map that into a user.
If you send from the address you have in fas, does it work?
Ahh I see. FAS doesn't allow more than one email address, as far as I can tell, and the email address I'm using is itself an alias just for receiving email, and I don't use for sending.
Yeah. :( I'm not sure how we could fix this... I suppose pagure could have a pref for additional email addresses? But that should be a pagure.io/pagure ticket...
Let us know if there's anything further we can do here.
Metadata Update from @kevin: - Issue close_status updated to: Will Not/Can Not fix - Issue status updated to: Closed (was: Open)
pagure.io does have multiple email addresses for me already but I guess whatever does mail handling is checking for veracity before it even gets to pagure.io?
https://pagure.io/settings#nav-email-tab
Huh, and the one you replied from is listed there?
Yes, 2 of 3.
I got curious if using the FAS email would really work, so I added bugzilla@color as a sending identity in Fastmail, replied to this ticket with From as bugzilla@color, and I get a bounce back from it too.
Metadata Update from @chrismurphy: - Issue status updated to: Open (was: Closed)
[backlog_refinement]
Sorry this has languished.
Is it still happening?
I think we need to investigate more and try and come up with what might be happening. The multiple addresses theory doesn't seem to have panned out.
Yes, replies still bounce back. Attached is the raw text bounce email I received.
<img alt="test_reply_bounce_raw.txt" src="/fedora-infrastructure/issue/raw/files/bd1ad76ebc52490a6a8a49121470beea03d3fafb4234d224d79ffb8a8dfc6a37-test_reply_bounce_raw.txt" />
This one sounds quite similar to https://pagure.io/fedora-infrastructure/issue/6352
Metadata Update from @zlopez: - Issue untagged with: low-trouble - Issue tagged with: Needs investigation
The previous message received by email to address bugzilla@colorremedies.com and my reply by email was from bugzilla@colorremedies.com using fastmail - but it bounces back almost immediately. Attaching the file in the bounce message.
<img alt="Email.eml" src="/fedora-infrastructure/issue/raw/files/1a008efb6d4490adc0084269745bd09f11ac37b7dcaa8525b76d32041f35404c-Email.eml" />
Trying to see if this is still going on or if we have an ongoing problem.
On Mon, 24 Apr 2023 at 13:23, Chris Murphy pagure@pagure.io wrote:
chrismurphy added a new comment to an issue you are following: `` The previous message received by email to address bugzilla@colorremedies.com and my reply by email was from bugzilla@colorremedies.com using fastmail - but it bounces back almost immediately. Attaching the file in the bounce message. <img alt="Email.eml" src="/fedora-infrastructure/issue/raw/files/1a008efb6d4490adc0084269745bd09f11ac37b7dcaa8525b76d32041f35404c-Email.eml" /> `` To reply, visit the link below or just reply to this email https://pagure.io/fedora-infrastructure/issue/10845
chrismurphy added a new comment to an issue you are following: `` The previous message received by email to address bugzilla@colorremedies.com and my reply by email was from bugzilla@colorremedies.com using fastmail - but it bounces back almost immediately. Attaching the file in the bounce message.
<img alt="Email.eml" src="/fedora-infrastructure/issue/raw/files/1a008efb6d4490adc0084269745bd09f11ac37b7dcaa8525b76d32041f35404c-Email.eml" /> ``
To reply, visit the link below or just reply to this email https://pagure.io/fedora-infrastructure/issue/10845
-- Stephen Smoogen, Red Hat Automotive Let us be kind to one another, for most of us are fighting a hard battle. -- Ian MacClaren
OK so something going on with fastmail.com talking with pagure.io versus say gmail.com talking to pagure.io.
Apr 24 17:22:17 pagure02 postfix/smtpd[1147374]: 1C76A8941C: client=wout2-smtp.messagingengine.com[64.147.123.25] Apr 24 17:22:17 pagure02 postfix/cleanup[1147382]: 1C76A8941C: message-id=<9ec90b10-5c54-415d-a61f-030c175e7cba@app.fastmail.com> Apr 24 17:22:17 pagure02 postfix/cleanup[1147382]: 1C76A8941C: milter-reject: END-OF-MESSAGE from wout2-smtp.messagingengine.com[64.147.123.25]: 5.7.1 Reply authentication failed.; from=<bugzilla@colorremedies.com> to=<reply+e56209643c8f4b7279986aadcd8362b4e1891dfdfc37a34ef08dda7ac691b99bd50815ea50183da7a0600c0875905162601ddb1b7a1c21b1e476024cc9f9cebe@pagure.io> proto=ESMTP helo=<wout2-smtp.messagingengine.com>
The only system I see any messages like this are with the srvers from messagingengine.com
@chrismurphy Could you reach to your e-mail provider with this issue? It seems that this is something on their side.
Metadata Update from @zlopez: - Issue priority set to: Waiting on Reporter (was: Waiting on Assignee)
Closing this issue as there was no response from reporter for 5 months. We did what we could from Fedora Infrastructure side. Feel free to reopen the issue if it's still happening.
Metadata Update from @zlopez: - Issue close_status updated to: Insufficient data - Issue status updated to: Closed (was: Open)
Login to comment on this ticket.